China's original factory peptide Cagrilintide 5mg/10mg for export

Q: Where is your company located?

Our company Our Factory is located at Unit 2, 7th Floor, No. 21 Liuhe Road, Ganjingzi District, Dalian City, Liaoning Province. Welcome to visit us.

Q: What is your after-sales policy?

We offer a quality guarantee for China's original factory peptide Cagrilintide 5mg/10mg for export. If there are any quality issues, please contact our support team at Unit 2, 7th Floor, No. 21 Liuhe Road, Ganjingzi District, Dalian City, Liaoning Province.

Q: How long is the delivery time?

Delivery time depends on the order quantity (current MOQ is 10). Generally, it takes 15-30 days after receiving the deposit.

Q: What is the MOQ for this product?

The minimum order quantity for China's original factory peptide Cagrilintide 5mg/10mg for export is 10 Item.

$0.60 / Item 10 Piece (MOQ)

Features/Highlights: ♔ Brief Introduction: Cagrilintide is a novel, long-acting amylin analogue developed by Novo Nordisk, it is a dual agonist of the amylin and calcitonin receptors and is primarily used for weight management in individuals with obesity or overweight.

Trading Conditions: 1000 Item MOQ 10 Item MAX Order 1000 Item

Shipping Port: ChinaGuangdong

Chat with Supplier

DALIAN HANDOM CHEMICALS CO.,LTD.

Trust points:

💼worldwide

✅Payment Method :T/T

📅Founded：2022 📊size：50-99 💰Revenue:10,10KCNY

📦Address:Unit 2, 7th Floor, No. 21 Liuhe Road, Ganjingzi District, Dalian City, Liaoning Province

China-Liaoning

Product Information
FAQ

Appearance: White or almost white powder

Package: 10 Vials per Kit

model: HDC-CAGRILINTIDE-003

content: 99.00

♔ Sequence:
{Eicosanedioic-acid-$\gamma$-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2

♔ Key Mechanisms of Action:

• Mimicking Satiety: Amylin is a pancreatic hormone naturally secreted by the body that signals satiety to the brain. As a long-acting analogue, cagrilintide significantly enhances this sensation of fullness and reduces food intake.

• Dual-Receptor Agonism: It non-selectively binds to and activates both the amylin receptor (AMYR) and the calcitonin receptor (CTR), primarily promoting a reduction in adipose tissue mass and thereby achieving significant weight loss.

♔ Clinical Applications and Research Progress:

• Monotherapy: Clinical trials indicate that cagrilintide demonstrates promising weight-loss potential and tolerability in overweight and obese populations.

• Combination Therapy (CagriSema): Cagrilintide is frequently used in combination with GLP-1 receptor agonists (such as semaglutide). This combination of two drugs with distinct mechanisms for inducing satiety—known as CagriSema—has demonstrated superior synergistic weight-loss effects in clinical trials.